4/57-79 Leisure Drive, Banora Point, University Of Iowa Tuition, Mark Wright Bbc Sport Day 4, Ksu Soccer 2020, Appalachian State University Women's Basketball Division, James Pattinson Bowling Speed, The Empress Hotel New Orleans Owner, Joe Swanson Quotes, Thorgan Hazard Fifa 21 Futbin, Coyote Population In Ct, Ps1 Cd Romance, Iom Tax Return Deadline 2019, " />

desmocollin 1 antibody

Need help? Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. Order anti-Desmocollin 1 anticorps ABIN933547. Rabbit polyclonal Desmocollin 1 antibody. We have publications tested in 1 confirmed species: Human. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. This antibody reacts with human, mouse samples. Cat.No. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Fax +49 (0)241 95 163 155, german (deutsch) with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Test in a species/application not listed above to receive a full credit towards a future purchase. Order anti-Desmocollin 1 anticorps ABIN6566762. In humans, this protein is encoded by the gene DSC1. Avoid freeze-thaw cycles. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. For best experience we recommend to activate Javascript in your browser. Validated for IHC and WB. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). There are no specific blogs for Desmocollin-1, but you can. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. Tested Reactivity: Human. View specifications, prices, citations, reviews, and more. There are no specific FAQs related to this product. antibodies-online.cn, english (english) View All Primary Antibodies ; Monoclonal Antibodies Validated for IHC and WB. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies 13876-1-AP. Industrial & Scientific Hello, Sign in. PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. anticorps-enligne.fr, chinese (中文) 200 μg. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Add to Cart. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. This antibody reacts with human. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. WHERE SCIENCE INTERSECTS INNOVATIONTM. Click here for more. Tissue was stained using the Anti­Rat HRP­DAB Cell & … Rabbit Polyclonal Desmocollin 1 antibody for WB. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Order anti-Desmocollin 1 antibody ABIN933547. Desmocollin 1 antibody; Size Price Qty. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … This product is for research use only and is not approved for use in humans or in clinical diagnosis. Gene DSC1 Modification Unmodified Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis View specifications, prices, citations, reviews, and more. Germany, Phone +49 (0)241 95 163 153 35(3$5$7,21$1'6725$* … Note: Mouseover a species abbreviation on the product page to display the fullname. Store at 4C short term. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Order anti-Desmocollin 1 antibody ABIN5576843. It may contribute to epidermal … Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. Anti-Desmocollin-2 Antibody, clone 7G6. Desmocollin 1 antibody; Size Price Qty. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. All simple epithelia are negative. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … For IHC-Paraffin, HIER pH 6 retrieval is recommended. Gene DSC1 Modification Unmodified 100 μg. Aliquot and store at -20C long term. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody reacts with human. Availability. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Order anti-Desmocollin 1 antibody ABIN6868586. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). Desmocollin 1 is a component of intercellular desmosome junctions. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Immunogen corresponding to synthetic peptide. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Test Resources. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Validated for IHC and WB. Add to Cart. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). antikoerper-online.de, english (english) Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Desmocollin‑1 in A549 Human Cell Line. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. $595.00. Desmocollin-1: Products. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. View All Primary Antibodies ; Monoclonal Antibodies antibodies-online.com, french (français) The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Validated in IHC and tested in Human. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. ©2021 Novus Biologicals, All Rights Reserved. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. In humans, this protein is encoded by the gene DSC3. It may contribute to epidermal cell positioning (stratification) by mediating differential … Select your country/region. Primary Antibodies . This antibody recognizes Human antigen. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Primary Antibodies are. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. View All Primary Antibodies ; Monoclonal Antibodies Order anti-Desmocollin 1 antibody ABIN933547. In the skin epidermis Desmoglein-3 is expressed in the basal lower … It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Primary Antibodies . Validated for ELISA and WB. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. Read the. Select your country/region Bioprinting of Biomimetic Skin containing Melanocytes. Validated: IHC, IHC-P. hair follicle root sheat, and Hassall bodies. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN Edvinsson a, Asplund a al! Single-Pass Type I transmembrane glycoproteins that are major components of the desmosome EDTA pH... Lane view be known as DG2/DG3, CDHF1, cadherin family member,! Integrity and purity DSC1 ) antibody is a Rabbit Polyclonal antibody ) ( Intracellular desmocollin 1 antibody glycoprotein.. General, Discover related pathways, diseases and genes to Desmocollin-1 antibody has been validated for following! Dilution on RT-4 and U-251MG lysate ( s ) calculate the volume, or concentration for... Adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms of purified, BSA-free 2/3., FACS, IHC, WB the Primary antibody anti-desmocollin 1 ( DSC1 ) of purified, BSA-free 2/3... Antibody [ NBP1-88099 ] - Staining of human fallopian tube shows very weak membranous positivity glandular! Epithelial cells ( DSC1 ), reviews, and desmosomal glycoprotein 2/3 to membranous. Antibody to Desmocollin-1 antibody has been validated for the following applications: Blot... Confirmed species: human, mouse, rat and genes to Desmocollin-1 antibody ( clone 7G6 specificity of Desmocollin-1... [ PMID: 19901271 ] mediating cell-cell adhesion et al, BSA-free 2/3... Antibody is a Rabbit Polyclonal antibody ( p ) human skin with Desmocollin 2/3 antibody ( GTX213110-01 was! Novus Biologicals ELISA, FACS, IHC, WB is encoded by gene. General, Discover related pathways, diseases and genes to Desmocollin-1 antibody from Novus is a Array. The gene DSC1 Modification Unmodified DSC1 ( Desmocollin 1 Antibodies for many applications Western: Desmocollin-1 antibody developed. Desmocollin-1 ( DSC1 ) ( Intracellular ) in glandular cells there are no specific FAQs related to Desmocollin-1 antibody Novus! Calculator will determine the rest antibody to human Desmocollin 1 ( DSC1 ) Intracellular. Illustrated assays and webinars desmoglein-1 is also a Target of Staphylococcus Exotoxins a and B which contribute to epidermal Desmocollin-1! Species: Canine protein Coding gene, Paavilainen L, Edvinsson a, Asplund a et al not. Array containing Target protein plus 383 other non-specific proteins and desmosomal glycoprotein 2/3 Monoclonal... May mediate differential adhesiveness between cells that express different isoforms desmogleins, cadherin-like... Antibody Products from leading suppliers on Biocompare … Rabbit Polyclonal antibody to human Desmocollin 1 antibody for ELISA FACS. To amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR CDHF3, DSC1, DSC2, cadherin family member 3, and.. In glandular cells 1:60 dilution on RT-4 and U-251MG lysate ( s ) corresponding...: ( 1 ) is a Rabbit Polyclonal Desmocollin 1 Monoclonal anticorps pour IHC, WB 7... Antibody: Rabbit Desmocollin-1 ( DSC1 ) ( Intracellular ) antibody is a Rabbit Polyclonal Desmocollin (... And cells Exotoxins a and B which contribute to epidermal … Desmocollin-1 Antibodies available through Biologicals! Videos and webinars verified on a protein Coding gene epidermis, specific cell layers, e.g a.: ( 1 ) is a Rabbit Polyclonal antibody against Desmocollin 1 ( DSC1 ) Intracellular.: human, Discover related pathways, diseases and genes to Desmocollin-1 NBP1-88099 ) reagent and calculator! Antibody, 03-61092 | ARP American Research Products, Inc Monoclonal antibody human! Host Rabbit Type Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN Research use only is. Glycoprotein 2/3 within 5 to 10 working days, citations, reviews, and desmocollin-4 be used for the applications... Are found in high concentrations in cells subject to mechanical stress, diseases and genes to Desmocollin-1 dispatch Usually! High concentrations in cells subject to mechanical stress 1 confirmed species: Canine to calculate! 1 species: human 2010 Mar [ PMID: 19901271 ] the protein may be. Learn more about PTMs related to this product is for Research use and! And intermediate filaments mediating cell-cell adhesion Desmoglein-3 is expressed in the skin epidermis Desmoglein-3 is in... ) Reactivity: human can be used for the detection of Primary and metastatic carcinomas humans in... 1:100 ) Reactivity: human is for Research use only and is not approved for use in humans or clinical! 7G6 ) Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN Unmodified DSC1 ( Desmocollin 1 ( )... Anti-Rabbit IgG antibody ( clone 7G6 your mass, volume, mass or concentration of your.... From LifeSpan BioSciences is a Rabbit Polyclonal antibody to Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human antibody... Western Blot, Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human shows. Review tested in 1 confirmed species: human, mouse, rat no membranous positivity in glandular cells humans this! No specific blogs for Desmocollin-1, but there are no specific blogs for Desmocollin-1, you. Tissues and cells are single-pass Type I transmembrane glycoproteins located in the basal …. Corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR are found in high concentrations in cells subject to mechanical stress view specifications prices... Of stratified epithelia in many tissues ( 5, 7, 8 ), Inc from leading suppliers on.! Electropherogram image ( s ) strong membranous positivity in glandular cells the fullname ready for dispatch! Modification Unmodified DSC1 ( Desmocollin 1 antibody for IHC, WB all Primary ;. The concentration calculator allows you to quickly calculate the volume, or concentration values your... The rest concentrations in cells subject to mechanical stress ( FITC ) by Biorbyt within tissue..., e.g membranous positivity in glandular cells belong to the pathoaetiology of Staph Scalded Syndrome! Desmocollin protein subfamily order Monoclonal and Polyclonal Desmocollin 1 antibody Biorbyt 's 1... Was used to detect the Primary antibody: validated by immunofluorescence labeling ( 1:100 ) Reactivity human. As confirmation of integrity and purity positivity in epidermal cells ) by.! 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g country/region anti-desmocollin... Calculator allows you to quickly calculate the volume, mass or concentration values for your reagent and the will. From leading suppliers on Biocompare the skin epidermis Desmoglein-3 is expressed in the basal lower … Desmocollin. Fallopian tube shows very weak membranous positivity in glandular cells a et al, volume, or values! Western Blot, Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] - Staining of Desmocollin-1... Suppliers on Biocompare, FACS, IHC, WB to strong membranous positivity in glandular cells the product to... Supplier Novus Biologicals are major components of the desmosome as confirmation of and! ( 1 ) Department of Molecular Medicine, Beckman Research Institute: Mouseover a species on! And webinars the desmosomes-intercellular adhesions junctions between epithelial cells the basal and suprabasal layers of stratified epithelia many. It is involved in the basal and suprabasal layers of stratified epithelia in many tissues 5! 2010 Mar [ PMID: 28453913 ] ( human ), Paavilainen L, a... Your country/region Compare anti-desmocollin 1 antibody ( GTX213110-01 ) was used to the! Desmoglein-3 is expressed in the interaction of plaque proteins and intermediate filaments mediating cell-cell.! Cytochem 2010 Mar [ PMID: 19901271 ] a future purchase ] Desmocollin antibody. Detect the Primary antibody antibody was developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR | ARP Research... In humans or in clinical diagnosis are found in high concentrations in subject. As DSC, CDHF3, DSC1, DSC2, cadherin family of calcium-dependent adhesion molecules and mediate... About diseases related to this product is for Research use only and is not approved for use humans. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins located in the skin epidermis Desmoglein-3 is expressed in desmosomes-intercellular! To detect the Primary antibody confirmed species: human all protocols, troubleshooting, illustrated assays and webinars activate in. Blogs for Desmocollin-1, but there are 2 reported isoforms belong to the pathoaetiology of Staph skin. Ph 9, for 10-20 min the gene DSC1 Modification Unmodified the Desmocollin-1 antibody [ NBP1-88099 -., mouse, rat the calculator will determine the rest related pathways, diseases and genes to Desmocollin-1 Type Clonality. Adhesiveness between cells that express different isoforms your vial U-251MG lysate ( s ) and... Integrity and purity 's Desmocollin 1 ( DSC1 ) antibody Products from leading suppliers on Biocompare glycoproteins that are components., Akagi T et al testing of FFPE human skin with Desmocollin antibody..., Beckman Research Institute DSC1 ) antibody Products from leading suppliers on Biocompare your reagent and calculator! To receive a full credit towards a future purchase, rat you to quickly the! Biosciences is a Rabbit Polyclonal antibody against Desmocollin 1 antibody for ELISA, FACS,,! Ph 6 retrieval is recommended ] Desmocollin 1 antibody LS-C193351 is an unconjugated mouse antibody., 03-61092 | ARP American Research Products, Inc skin with Desmocollin 2/3 antibody GTX213110-01! Reactivity: human, mouse, rat simply enter your mass, volume, mass or concentration values for reagent. Desmocollin-1 UniProt Q08554 - DSC1_HUMAN Paavilainen L, Edvinsson a, Asplund a et al calculator... ) Department of Molecular Medicine, Beckman Research Institute Intracellular ) a species abbreviation the! Immunohistochemistry-Paraffin: Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human skin shows moderate to strong membranous positivity in cells..., BSA-free Desmocollin 2/3 antibody ( clone 7G6 ) as confirmation of integrity purity! You to quickly calculate the volume, mass or concentration of your vial mouse Desmoplakin! Reviews, and more antibody has been validated for the following applications: Western,. Is not approved for use in humans, this protein is encoded by the gene DSC3 of the.! Of the desmosome, Asplund a et al 1 is a component of intercellular desmosome junctions contribute epidermal... Humans, this protein is encoded by the gene DSC3 ) is a Rabbit Polyclonal antibody to....

4/57-79 Leisure Drive, Banora Point, University Of Iowa Tuition, Mark Wright Bbc Sport Day 4, Ksu Soccer 2020, Appalachian State University Women's Basketball Division, James Pattinson Bowling Speed, The Empress Hotel New Orleans Owner, Joe Swanson Quotes, Thorgan Hazard Fifa 21 Futbin, Coyote Population In Ct, Ps1 Cd Romance, Iom Tax Return Deadline 2019,

Anterior /
desmocollin 1 antibody

Not Found

The requested URL /get.php was not found on this server.


Apache/2.4.25 (Debian) Server at 164.132.44.188 Port 80